{"product_id":"proteintech-20847-1-ap","title":"Proteintech, 20847-1-AP, GPR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR3 (20847-1-AP) by Proteintech is a Polyclonal antibody targeting GPR3 in IHC, ELISA applications with reactivity to human, mouse samples\n20847-1-AP targets GPR3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14257 Product name: Recombinant human GPR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-330 aa of BC032702 Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV Predict reactive species\nFull Name: G protein-coupled receptor 3\nCalculated Molecular Weight: 330 aa, 35 kDa\nGenBank Accession Number: BC032702\nGene Symbol: GPR3\nGene ID (NCBI): 2827\nRRID: AB_2878749\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46089\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869546238121,"sku":"20847-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20847-1-ap","provider":"Iright","version":"1.0","type":"link"}