{"product_id":"proteintech-20865-1-ap","title":"Proteintech, 20865-1-AP, TFPI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFPI (20865-1-AP) by Proteintech is a Polyclonal antibody targeting TFPI in WB, IF\/ICC, ELISA applications with reactivity to human samples\n20865-1-AP targets TFPI in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTissue factor pathway inhibitor (TFPI) is a critical anticoagulant protein present in endothelium and platelets. TFPI is produced as two major isoforms in humans, TFPIa and TFPIb that result from alternative splicing. The TFPIb isoform localizes to the endothelium surface where it is a potent inhibitor of tissue factor-factor VIIa complexes that initiate blood coagulation. The TFPIa isoform is present in platelets. TFPI is a Kunitz-type serine protease inhibitor that exerts anticoagulant activity by blocking early procoagulant stimulia. TFPI can enhance anti-thrombotic treatment in sepsis, inflammatory diseases, and cardiovascular diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14913 Product name: Recombinant human TFPI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-208 aa of BC015514 Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSL Predict reactive species\nFull Name: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)\nCalculated Molecular Weight: 251aa,29 kDa; 304aa,35 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC015514\nGene Symbol: TFPI\nGene ID (NCBI): 7035\nRRID: AB_10693682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10646\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869436498089,"sku":"20865-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20865-1-ap","provider":"Iright","version":"1.0","type":"link"}