{"product_id":"proteintech-20869-1-ap","title":"Proteintech, 20869-1-AP, RHBDD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHBDD1 (20869-1-AP) by Proteintech is a Polyclonal antibody targeting RHBDD1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20869-1-AP targets RHBDD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  mouse testis tissue,  PC-3 cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14932 Product name: Recombinant human RHBDD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-106 aa of BC027900 Sequence: SSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ Predict reactive species\nFull Name: rhomboid domain containing 1\nCalculated Molecular Weight: 315 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC027900\nGene Symbol: RHBDD1\nGene ID (NCBI): 84236\nRRID: AB_10733756\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TEB9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869427060905,"sku":"20869-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20869-1-ap","provider":"Iright","version":"1.0","type":"link"}