{"product_id":"proteintech-20870-1-ap","title":"Proteintech, 20870-1-AP, GABPB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GABPB2 (20870-1-AP) by Proteintech is a Polyclonal antibody targeting GABPB2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n20870-1-AP targets GABPB2 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  A375 cells,  HEK-293 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGABPB2 is a subunit of the GA-binding protein (GABP) transcription factor, which is a heterodimeric complex. The GABP complex plays a role in the regulation of gene transcription by binding to specific DNA sequences. GABPB2 specifically contributes to the transactivation of target genes (PMID: 18628204). The protein is primarily located in the nucleus. It is ubiquitously expressed in various tissues, including testis, ovary, and others. Studies have shown that GABPB2 is dispensable for normal lymphocyte development but moderately affects B cell responses (PMID: 18628204). Mice deficient in GABPB2 exhibit increased B cell proliferation and antibody production in response to certain stimuli. The molecular weight of GABPB2 is 48 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14933 Product name: Recombinant human GABPB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 129-220 aa of BC027033 Sequence: DVHAFSKFDKSAFDIALEKNNAEILVILQEAMQNQVNVNPERANPVTDPVSMAAPFIFTSGEVVNLASLISSTNTKTTSGDPHASTVQFSNS Predict reactive species\nFull Name: GA binding protein transcription factor, beta subunit 2\nCalculated Molecular Weight: 448 aa, 49 kDa\nObserved Molecular Weight: 49 kDa\nGenBank Accession Number: BC027033\nGene Symbol: GABPB2\nGene ID (NCBI): 126626\nRRID: AB_10734321\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TAK5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869685633193,"sku":"20870-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20870-1-ap","provider":"Iright","version":"1.0","type":"link"}