{"product_id":"proteintech-20880-1-ap","title":"Proteintech, 20880-1-AP, TMEM243 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM243 (20880-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM243 in IHC, IP, ELISA applications with reactivity to human samples\n20880-1-AP targets TMEM243 in IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: Ramos cells\nPositive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC7orf23, also known as TMEM243, encodes a membrane protein that may be associated with drug tolerance in cells. The C7orf23 gene is capable of generating at least 12 different splice variants, 10 of which are capable of encoding 7 different protein isoforms, some of which contain transmembrane structural domains. Recent studies have shown that C7orf23 is significantly up-regulated and highly sensitive in blood samples from PD patients, revealing its potential as a future biomarker for PD diagnosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14979 Product name: Recombinant human C7orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002837 Sequence: MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR Predict reactive species\nFull Name: chromosome 7 open reading frame 23\nCalculated Molecular Weight: 118 aa, 13 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC002837\nGene Symbol: C7orf23\nGene ID (NCBI): 79161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BU79\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887832027305,"sku":"20880-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20880-1-ap","provider":"Iright","version":"1.0","type":"link"}