{"product_id":"proteintech-20899-1-ap","title":"Proteintech, 20899-1-AP, BRAF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRAF (20899-1-AP) by Proteintech is a Polyclonal antibody targeting BRAF in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n20899-1-AP targets BRAF in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, HEK-293 cells,  HeLa cells,  K-562 cells,  Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: human lymphoma tissue, human malignant melanoma tissue,  human testis tissue,  human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB-Raf proto-oncogene serine\/threonine kinase(BRAF), is a protein belonging to the raf\/mil family of serine\/threonine protein kinases. BRAF plays a role in regulating the MAP kinase\/ERKs signaling pathway, which affects cell division, differentiation, and secretion. BRAF is associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. BRAF is also associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. BRAF plays a role in the PD-1\/PDL-1 pathway. In some cancers, BRAF is activated by rearrangements that fuse its kinase domain to 5' partner genes and then has different molecular weights (PMID: 23890088). BRAF has several isoforms, the calculated molecular weight of  BRAF is 84 kDa, but the observed molecular weight is about 65 kDa(isoform).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15014 Product name: Recombinant human BRAF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 500-766 aa of BC101757 Sequence: NEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH Predict reactive species\nFull Name: v-raf murine sarcoma viral oncogene homolog B1\nCalculated Molecular Weight: 766 aa, 84 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC101757\nGene Symbol: BRAF\nGene ID (NCBI): 673\nRRID: AB_2878760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15056\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883833001,"sku":"20899-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20899-1-ap","provider":"Iright","version":"1.0","type":"link"}