{"product_id":"proteintech-20936-1-ap","title":"Proteintech, 20936-1-AP, DPCD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DPCD (20936-1-AP) by Proteintech is a Polyclonal antibody targeting DPCD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n20936-1-AP targets DPCD in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, human testis tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDPCD (for deleted in a mouse model of primary ciliary dyskinesia), is predicted to code for a protein of 23 kDa which remains a novel candidate gene for PCD (Primary ciliary dyskinesia).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15029 Product name: Recombinant human RP11-529I10.4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC031695 Sequence: MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ Predict reactive species\nFull Name: deleted in a mouse model of primary ciliary dyskinesia\nCalculated Molecular Weight: 203 aa, 23 kDa\nObserved Molecular Weight: 23-26 kDa\nGenBank Accession Number: BC031695\nGene Symbol: DPCD\nGene ID (NCBI): 25911\nRRID: AB_10734461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVM2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869532442793,"sku":"20936-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20936-1-ap","provider":"Iright","version":"1.0","type":"link"}