{"product_id":"proteintech-20948-1-ap","title":"Proteintech, 20948-1-AP, TRIM52 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRIM52 (20948-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM52 in WB, IHC, ELISA applications with reactivity to human samples\n20948-1-AP targets TRIM52 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, OVCAR-3 cells,  SKOV-3 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRIM52 (Tripartite motif 52) is a member of the family of highly conserved RBCC (a RING-finger, two B-boxes, and a predicted alpha-helical Coiled-Coil domain were linked to the N-terminal region in sequence) proteins with more than 70 isoforms, which plays an important role in tumorigenesis through different signaling pathways (PMID: 35837156). TRIM52 promotes tumorigenesis in ovarian cancer by activating the nuclear factor (NF)-κB signaling pathway. Knocking-down of TRIM52 in ovarian cancer cells suppresses cell invasion, cell migration and cell proliferation, while inducing apoptosis (PMID: 30918473, 28073078).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15064 Product name: Recombinant human TRIM52 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-297 aa of BC007372 Sequence: MAGYATTPSPMQTLQEEAVCAICLDYFKDPVSISCGHNFCRGCVTQLWSKEDEEDQNEEEDEWEEEEDEEAVGAMDGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEEEEEEEDQDYYLGGLRPDLRIDVYREEEILEAYDEDEDEELYPDIHPPPSLPLPGQFTCPQCRKSFTRRSFRPNLQLANMVQIIRQMCPTPYRGNRSNDQGMCFKHQEALKLFCEVDKEAICVVCRESRSHKQHSVLPLEEVVQEYQEIKLETTLVGILQIEQESIHSKAYNQ Predict reactive species\nFull Name: tripartite motif-containing 52\nCalculated Molecular Weight: 297 aa, 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC007372\nGene Symbol: TRIM52\nGene ID (NCBI): 84851\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96A61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887838777513,"sku":"20948-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-20948-1-ap","provider":"Iright","version":"1.0","type":"link"}