{"product_id":"proteintech-21089-1-ap","title":"Proteintech, 21089-1-AP, GPRC5D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPRC5D (21089-1-AP) by Proteintech is a Polyclonal antibody targeting GPRC5D in WB, IHC, ELISA applications with reactivity to human samples\n21089-1-AP targets GPRC5D in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MG-63 cells,  THP-1 cells,  U266 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15338 Product name: Recombinant human GPRC5D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-345 aa of BC069341 Sequence: LYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV Predict reactive species\nFull Name: G protein-coupled receptor, family C, group 5, member D\nCalculated Molecular Weight: 345 aa, 39 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC069341\nGene Symbol: GPRC5D\nGene ID (NCBI): 55507\nRRID: AB_2878810\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887658717353,"sku":"21089-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21089-1-ap","provider":"Iright","version":"1.0","type":"link"}