{"product_id":"proteintech-21090-1-ap","title":"Proteintech, 21090-1-AP, CHCHD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHCHD4 (21090-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21090-1-AP targets CHCHD4 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, human heart tissue,  mouse lung tissue,  mouse spleen tissue,  L02 cells,  mouse kidney tissue,  Ramos cells,  Raji cells,  rat brain tissue,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHCHD4, a component of human mitochondria, belongs to a protein family. It functions as chaperone and catalyzes the formation of disulfide bonds in substrate proteins, such as COX17. It is required for the import and folding of small cysteine-containing proteins (small Tim) in the mitochondrial intermembrane space (IMS).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15339 Product name: Recombinant human CHCHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC033775 Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS Predict reactive species\nFull Name: coiled-coil-helix-coiled-coil-helix domain containing 4\nCalculated Molecular Weight: 142 aa, 16 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC033775\nGene Symbol: CHCHD4\nGene ID (NCBI): 131474\nRRID: AB_10734583\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N4Q1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861288617,"sku":"21090-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21090-1-ap","provider":"Iright","version":"1.0","type":"link"}