{"product_id":"proteintech-21094-1-ap","title":"Proteintech, 21094-1-AP, LHFPL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LHFPL4 (21094-1-AP) by Proteintech is a Polyclonal antibody targeting LHFPL4 in WB, ELISA applications with reactivity to human, mouse samples\n21094-1-AP targets LHFPL4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLHFPL4, or Lipoma HMGIC Fusion Partner-Like 4, is a member of the tetraspanin superfamily of transmembrane proteins. LHFPL4 interacts tightly with GABAAR subunits and is selectively enriched at inhibitory synapses. It is important for GABAAR clustering both in vitro and in vivo, and it is required for surface clustering but not the trafficking of GABAARs (PMID: 28978485).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15349 Product name: Recombinant human LHFPL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-247 aa of BC113964 Sequence: LGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP Predict reactive species\nFull Name: lipoma HMGIC fusion partner-like 4\nCalculated Molecular Weight: 247 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC113964\nGene Symbol: LHFPL4\nGene ID (NCBI): 375323\nRRID: AB_3669357\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen Affinity purified\nUNIPROT ID: Q7Z7J7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887703347369,"sku":"21094-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21094-1-ap","provider":"Iright","version":"1.0","type":"link"}