{"product_id":"proteintech-21100-1-ap","title":"Proteintech, 21100-1-AP, ANKRD13D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKRD13D (21100-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD13D in WB, IHC, ELISA applications with reactivity to human samples\n21100-1-AP targets ANKRD13D in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HT-1080 cells\nPositive IHC detected in: human small intestine tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKRD13D, also named as Ankyrin repeat domain-containing protein 13D, is a 518 amino acid protein, which contains 4 UIM (ubiquitin-interacting motif) repeats. ANKRD13D localizes in the cell membrane and late endosome. ANKRD13D as a ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. The calculated molecular weight of ANKRD13D is 58kDa, but we decteted a 50kDa protein via western blot. experiment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15369 Product name: Recombinant human ANKRD13D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 284-367 aa of BC110419 Sequence: LSDQDKSRSKAGKTPFQSFLGMAQQHSSHTGAPVQQAASPTNPTAISPEEYFDPNFSLESRNIGRPIEMSSKVQRFKATLWLSE Predict reactive species\nFull Name: ankyrin repeat domain 13 family, member D\nCalculated Molecular Weight: 605 aa, 68 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC110419\nGene Symbol: ANKRD13D\nGene ID (NCBI): 338692\nRRID: AB_2878813\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZTN6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884970397865,"sku":"21100-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21100-1-ap","provider":"Iright","version":"1.0","type":"link"}