{"product_id":"proteintech-21113-1-ap","title":"Proteintech, 21113-1-AP, FAM101A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM101A (21113-1-AP) by Proteintech is a Polyclonal antibody targeting FAM101A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21113-1-AP targets FAM101A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  human skeletal muscle tissue,  mouse spleen tissue\nPositive IHC detected in: human stomach tissue,  human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15314 Product name: Recombinant human FAM101A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC141805 Sequence: MRPRMLPVFFGESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRNYRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQDPAPSLLGPATL Predict reactive species\nFull Name: family with sequence similarity 101, member A\nCalculated Molecular Weight: 216 aa, 24 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC141805\nGene Symbol: FAM101A\nGene ID (NCBI): 144347\nRRID: AB_10733877\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZTI6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887629881513,"sku":"21113-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21113-1-ap","provider":"Iright","version":"1.0","type":"link"}