{"product_id":"proteintech-21133-1-ap","title":"Proteintech, 21133-1-AP, LIPC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIPC (21133-1-AP) by Proteintech is a Polyclonal antibody targeting LIPC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21133-1-AP targets LIPC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse liver tissue,  HepG2 cells,  rat heart tissue\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIPC, also named as HTGL and HL, belongs to the AB hydrolase superfamily and Lipase family. It has the capacity to catalyze hydrolysis of phospholipids, mono-, di-, and triglycerides, and acyl-CoA thioesters. LIPC is an important enzyme in HDL metabolism. It binds heparin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15538 Product name: Recombinant human LIPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-463 aa of BC146659 Sequence: DASFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQLKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQR Predict reactive species\nFull Name: lipase, hepatic\nCalculated Molecular Weight: 499 aa, 56 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC146659\nGene Symbol: LIPC\nGene ID (NCBI): 3990\nRRID: AB_11041715\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11150\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868969423017,"sku":"21133-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21133-1-ap","provider":"Iright","version":"1.0","type":"link"}