{"product_id":"proteintech-21150-1-ap","title":"Proteintech, 21150-1-AP, SLITRK6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLITRK6 (21150-1-AP) by Proteintech is a Polyclonal antibody targeting SLITRK6 in WB, ELISA applications with reactivity to human, mouse, rat samples\n21150-1-AP targets SLITRK6 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLITRK6 is a member of the SLITRK family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. This protein functions as a regulator of neurite outgrowth required for normal hearing and vision. Mutations in SLITRK6 gene are a cause of myopia and deafness.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15701 Product name: Recombinant human SLITRK6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 621-816 aa of BC101070 Sequence: IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT Predict reactive species\nFull Name: SLIT and NTRK-like family, member 6\nCalculated Molecular Weight: 841 aa, 95 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC101070\nGene Symbol: SLITRK6\nGene ID (NCBI): 84189\nRRID: AB_10732812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5Y7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887808794793,"sku":"21150-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21150-1-ap","provider":"Iright","version":"1.0","type":"link"}