{"product_id":"proteintech-21160-1-ap","title":"Proteintech, 21160-1-AP, ELOVL6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELOVL6 (21160-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL6 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n21160-1-AP targets ELOVL6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human hepatocirrhosis tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag14163 Product name: Recombinant human ELOVL6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC001305 Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR Predict reactive species\nFull Name: ELOVL family member 6, elongation of long chain fatty acids (FEN1\/Elo2, SUR4\/Elo3-like, yeast)\nCalculated Molecular Weight: 265 aa, 31 kDa\nObserved Molecular Weight: 29-32 kDa\nGenBank Accession Number: BC001305\nGene Symbol: ELOVL6\nGene ID (NCBI): 79071\nRRID: AB_10694572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5J4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954644649,"sku":"21160-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21160-1-ap","provider":"Iright","version":"1.0","type":"link"}