{"product_id":"proteintech-21166-1-ap","title":"Proteintech, 21166-1-AP, MKL1\/MRTF-A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MKL1\/MRTF-A (21166-1-AP) by Proteintech is a Polyclonal antibody targeting MKL1\/MRTF-A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21166-1-AP targets MKL1\/MRTF-A in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IHC detected in: human small intestine tissue, human tonsillitis tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMegakaryocytic leukemia 1 (MKL1), also known as myocardin-related transcription factor A (MRTF-A), is a transcriptional regulator involved in a wide range of pathophysiological processes in the cardiovascular system. MKL1 was initially identified as a co-factor for serum response factor (SRF) to regulate the transcription of contractile genes. Forced expression of MKL1 in non-muscle cells leads to robust up-regulation of contractile genes (PMID: 36587486, PMID: 37199168, PMID: 39222836). MKL1 is ubiquitously expressed and has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart, and brain. The molecular weight of MKL1 observed is consistent with what has been described in the literature (PMID: 34944031).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15240 Product name: Recombinant human MKL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 392-741 aa of BC115039 Sequence: KAPAATSILHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQEN Predict reactive species\nFull Name: megakaryoblastic leukemia (translocation) 1\nCalculated Molecular Weight: 931 aa, 99 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC115039\nGene Symbol: MKL1\nGene ID (NCBI): 57591\nRRID: AB_2878822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969V6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868850933929,"sku":"21166-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21166-1-ap","provider":"Iright","version":"1.0","type":"link"}