{"product_id":"proteintech-21199-1-ap","title":"Proteintech, 21199-1-AP, KLHL35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KLHL35 (21199-1-AP) by Proteintech is a Polyclonal antibody targeting KLHL35 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21199-1-AP targets KLHL35 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse kidney tissue,  rat brain tissue,  rat kidney tissue\nPositive IHC detected in: human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15558 Product name: Recombinant human KLHL35 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 230-363 aa of BC042952 Sequence: RQGGVNTDKVQCFDPKEDRWSLRSPAPFSQRCLEAVSLEDTIYVMGGLMSKIFTYDPGTDVWGEAAVLPSPVESCGVTVCDGKVHILGGRDDRGESTDKVFTFDPSSGQVEVQPSLQRCTSSHGCVTIIQSLGR Predict reactive species\nFull Name: kelch-like 35 (Drosophila)\nCalculated Molecular Weight: 363 aa, 40 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC042952\nGene Symbol: KLHL35\nGene ID (NCBI): 283212\nRRID: AB_10693685\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PF15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887698530473,"sku":"21199-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21199-1-ap","provider":"Iright","version":"1.0","type":"link"}