{"product_id":"proteintech-21215-1-ap","title":"Proteintech, 21215-1-AP, ATOH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATOH1 (21215-1-AP) by Proteintech is a Polyclonal antibody targeting ATOH1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n21215-1-AP targets ATOH1 in WB, IHC, IF\/ICC, FC (Intra), chIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells, HepG2 cells,  mouse small intestine tissue,  mouse brain tissue,  rat brain tissue,  C6 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.4 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATOH1, also named as Protein atonal homolog 1 or BHLHA14, is a 364 amino acid protein, which contains 1 bHLH (basic helix-loop-helix) domain. ATOH1,as a transcriptional regulator in the nucleus activates E box-dependent transcription in collaboration with TCF3\/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. ATOH1 plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15615 Product name: Recombinant human ATOH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC069594 Sequence: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS Predict reactive species\nFull Name: atonal homolog 1 (Drosophila)\nCalculated Molecular Weight: 354 aa, 38 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC069594\nGene Symbol: ATOH1\nGene ID (NCBI): 474\nRRID: AB_10733126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92858\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841463977,"sku":"21215-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21215-1-ap","provider":"Iright","version":"1.0","type":"link"}