{"product_id":"proteintech-21232-1-ap","title":"Proteintech, 21232-1-AP, TAC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAC4 (21232-1-AP) by Proteintech is a Polyclonal antibody targeting TAC4 in IHC, ELISA applications with reactivity to human, mouse samples\n21232-1-AP targets TAC4 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTAC4, or tachykinin 4, is a gene that encodes for a member of the tachykinin family of peptides, which are known for their rapid stimulation of contraction in intestinal muscles and other physiological functions. The tachykinin family includes three members in mammals: TAC1, TAC3, and TAC4. TAC4, in particular, is involved in a variety of physiological roles and has been implicated in several biological processes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15702 Product name: Recombinant human TAC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC111858 Sequence: MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQF Predict reactive species\nFull Name: tachykinin 4 (hemokinin)\nCalculated Molecular Weight: 113 aa, 12 kDa\nGenBank Accession Number: BC111858\nGene Symbol: TAC4\nGene ID (NCBI): 255061\nRRID: AB_3669363\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887821901993,"sku":"21232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21232-1-ap","provider":"Iright","version":"1.0","type":"link"}