{"product_id":"proteintech-21243-1-ap","title":"Proteintech, 21243-1-AP, EPS15R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPS15R (21243-1-AP) by Proteintech is a Polyclonal antibody targeting EPS15R in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n21243-1-AP targets EPS15R in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BxPC-3 cells, MCF-7 cells,  HEK-293 cells,  Y79 cells\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:14000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPS15R is a protein that belongs to the Eps15 family of proteins, which are known for their roles in intracellular trafficking, particularly in the regulation of endocytosis and vesicle formation. EPS15R, like other members of the Eps15 family, functions as a scaffolding adaptor protein and is involved in both secretion and endocytosis. It has been shown to bind to AP-1 and AP-2 complexes, inositol lipids, and several other proteins that are crucial for the regulation of intracellular trafficking.\n\nEPS15R is also implicated in the regulation of membrane morphology, which is essential for intracellular vesicle formation and trafficking \n. It has been detected in the nucleus of mammalian cells, and its activation through growth factor receptors induces tyrosine phosphorylation and mono-ubiquitination, although the specific roles of these post-translational modifications are not yet fully understood\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15735 Product name: Recombinant human EPS15L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 351-597 aa of BC142716 Sequence: PQVLSPDMVPPSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEINQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAM Predict reactive species\nFull Name: epidermal growth factor receptor pathway substrate 15-like 1\nCalculated Molecular Weight: 864 aa, 94 kDa\nObserved Molecular Weight: 94 kDa\nGenBank Accession Number: BC142716\nGene Symbol: EPS15R\nGene ID (NCBI): 58513\nRRID: AB_10733643\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBC2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869535129769,"sku":"21243-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21243-1-ap","provider":"Iright","version":"1.0","type":"link"}