{"product_id":"proteintech-21248-1-ap","title":"Proteintech, 21248-1-AP, OSTbeta \/ SLC51B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSTbeta \/ SLC51B (21248-1-AP) by Proteintech is a Polyclonal antibody targeting OSTbeta \/ SLC51B in IHC, ELISA applications with reactivity to human samples\n21248-1-AP targets OSTbeta \/ SLC51B in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOrganic solute transporter alpha-beta (Ostα-Ostβ) is a heteromeric transporter that has been localized to the basolateral membrane of epithelial cells of the small intestine, kidney and liver, and appears to be essential for bile acid homeostasis. The transporter is composed of a predicted 340-amino acid, 7-transmembrane domain protein (Ostα) and a putative 128-amino acid, single-transmembrane domain polypeptide (Ostβ). Ostα-Ostβ transports bile acids by a facilitated diffusion mechanism; therefore, Ostα-Ostβ can mediate cellular efflux or uptake depending on the substrate's electrochemical gradient. It's reported that Ostα-Ostβ is not only essential for bile acid, but also vital for sterol disposition and  enterohepatic circulation(PMID: 21691099).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15751 Product name: Recombinant human OSTbeta protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC103842 Sequence: MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES Predict reactive species\nFull Name: organic solute transporter beta\nCalculated Molecular Weight: 128 aa, 14 kDa\nGenBank Accession Number: BC103842\nGene Symbol: SLC51B\nGene ID (NCBI): 123264\nRRID: AB_3085647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86UW2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869569241257,"sku":"21248-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21248-1-ap","provider":"Iright","version":"1.0","type":"link"}