{"product_id":"proteintech-21252-1-ap","title":"Proteintech, 21252-1-AP, FABP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FABP2 (21252-1-AP) by Proteintech is a Polyclonal antibody targeting FABP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21252-1-AP targets FABP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, mouse small intestine tissue,  rat small intestine tissue\nPositive IHC detected in: human stomach cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFABP2, also known as Intestinal Fatty Acid Binding Protein (I-FABP), is a member of the Fatty Acid Binding Proteins (FABPs) family. The cytoplasmic content of FABP2 could be delivered into the systematic circulation once the death of enterocyte happens, thus the elevated FABP2 concentration in the blood has been shown in many human intestinal diseases. FABP2 is a water soluble cytosolic protein with a small molecular weight of 14-15 kDa, and it is initially located in the mature enterocytes of the small intestine (PMID: 26547205).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15793 Product name: Recombinant human FABP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC069617 Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD Predict reactive species\nFull Name: fatty acid binding protein 2, intestinal\nCalculated Molecular Weight: 132 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC069617\nGene Symbol: FABP2\nGene ID (NCBI): 2169\nRRID: AB_10734425\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P12104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868897136809,"sku":"21252-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21252-1-ap","provider":"Iright","version":"1.0","type":"link"}