{"product_id":"proteintech-21284-1-ap","title":"Proteintech, 21284-1-AP, NT5C1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NT5C1A (21284-1-AP) by Proteintech is a Polyclonal antibody targeting NT5C1A in WB, ELISA applications with reactivity to human, mouse samples\n21284-1-AP targets NT5C1A in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNT5C1A (5′-nucleotidase cytosolic 1A) is a 365 amino acid protein belonging to the 5′-nucleotidase type 3 family.  AMP can be deaminated by AMP-deaminase (AMPD) to IMP, which is hydrolyzed to inosine by cytosolic 5'-nucleotidase II (NT5C2). AMP can also be hydrolyzed to adenosine by cytosolic 5'-nucleotidase 1A (NT5C1A). NT5C1A also assists in the regulation of adenosine levels in heart during ischemia and hypoxia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15802 Product name: Recombinant human NT5C1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC103880 Sequence: MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDVFD Predict reactive species\nFull Name: 5'-nucleotidase, cytosolic IA\nCalculated Molecular Weight: 368 aa, 41 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC103880\nGene Symbol: NT5C1A\nGene ID (NCBI): 84618\nRRID: AB_3085649\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BXI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887743193257,"sku":"21284-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21284-1-ap","provider":"Iright","version":"1.0","type":"link"}