{"product_id":"proteintech-21296-1-ap","title":"Proteintech, 21296-1-AP, MANEA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MANEA (21296-1-AP) by Proteintech is a Polyclonal antibody targeting MANEA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21296-1-AP targets MANEA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  mouse kidney tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15847 Product name: Recombinant human MANEA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-109 aa of BC146671 Sequence: LRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYS Predict reactive species\nFull Name: mannosidase, endo-alpha\nCalculated Molecular Weight: 462 aa, 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC146671\nGene Symbol: MANEA\nGene ID (NCBI): 79694\nRRID: AB_2878836\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5SRI9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887712424105,"sku":"21296-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21296-1-ap","provider":"Iright","version":"1.0","type":"link"}