{"product_id":"proteintech-21334-1-ap","title":"Proteintech, 21334-1-AP, CHD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHD2 (21334-1-AP) by Proteintech is a Polyclonal antibody targeting CHD2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n21334-1-AP targets CHD2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells,  K-562 cells\nPositive IHC detected in: rat brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromodomain helicase DNA binding protein 2 (CHD2), a member of the sucrose nonfermenting (SNF-2) protein family of epigenetic regulators, which use the energy from ATP hydrolysis to change nucleosome positioning, composition and chromatin structure(PMID: 33435571). CHD2 protein plays a critical role in embryonic development, tumor suppression and survival(PMID: 24834135). In addition, CHD2 has been proposed to prevent breast cancer initiation, and CHD2 mutations are associated with chronic lymphocytic leukemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15429 Product name: Recombinant human CHD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of BC020810 Sequence: MMRNKDKSQEEDSSLHSNASSHSASEEASGSDSGSQSESEQGSDPGSGHGSESNSSSESSESQSESESESAGSKSQPVLPEAKEKPASKKERIADVKKMWEEYPDVYGVRRSNRSRQEPSRFNIKEEASSGSESGSPKRRGQRQLKKQEKWKQEPSEDEQEQGTSAESEPEQKKVKARRPVPRRTVPKPRVKKQPKTQRGKRKKQDSSDEDDDDDEVPKRQTRRRAAKNV Predict reactive species\nFull Name: chromodomain helicase DNA binding protein 2\nCalculated Molecular Weight: 1828 aa, 211 kDa\nObserved Molecular Weight: 230-250 kDa\nGenBank Accession Number: BC020810\nGene Symbol: CHD2\nGene ID (NCBI): 1106\nRRID: AB_3085652\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14647\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886504530089,"sku":"21334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21334-1-ap","provider":"Iright","version":"1.0","type":"link"}