{"product_id":"proteintech-21340-1-ap","title":"Proteintech, 21340-1-AP, INE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INE1 (21340-1-AP) by Proteintech is a Polyclonal antibody targeting INE1 in WB, IHC, ELISA applications with reactivity to human samples\n21340-1-AP targets INE1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15601 Product name: Recombinant human INE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC069772 Sequence: MSGPLSPVCSCPQLPFMLSPCHMHHHPGHVALSQTVSPASLLTQGLGLPQH Predict reactive species\nFull Name: inactivation escape 1 (non-protein coding)\nCalculated Molecular Weight: 51 aa, 5 kDa\nObserved Molecular Weight: 5-8 kDa\nGenBank Accession Number: BC069772\nGene Symbol: INE1\nGene ID (NCBI): 8552\nRRID: AB_10859781\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887683817641,"sku":"21340-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21340-1-ap","provider":"Iright","version":"1.0","type":"link"}