{"product_id":"proteintech-21362-1-ap","title":"Proteintech, 21362-1-AP, USP17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP17 (21362-1-AP) by Proteintech is a Polyclonal antibody targeting USP17 in WB, ELISA applications with reactivity to human samples\n21362-1-AP targets USP17 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP17, also known as DUB3, is a deubiquitinating enzyme (DUB) that plays a key role in regulating the balance between ubiquitination and deubiquitination of proteins. This balance is essential for protein degradation, transport, localization, and activity. USP17 is inducibly expressed in response to cytokine, chemokine, and epidermal growth factor (EGF) stimulation, and several studies have shown that it is required for cell proliferation and migration. Aberrantly expressed USP17 has been associated with inflammation, cell motility, development of T helper 17 (Th17) cells and carcinogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15824 Product name: Recombinant human USP17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-317 aa of BC100991 Sequence: DIALDIQAAQSVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQYPECLDMQPYMSQQNTGPLVY Predict reactive species\nFull Name: ubiquitin specific peptidase 17\nCalculated Molecular Weight: 530 aa, 60 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC100991\nGene Symbol: USP17\nGene ID (NCBI): 391627\nRRID: AB_3669365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887918370985,"sku":"21362-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21362-1-ap","provider":"Iright","version":"1.0","type":"link"}