{"product_id":"proteintech-21368-1-ap","title":"Proteintech, 21368-1-AP, ASCL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASCL2 (21368-1-AP) by Proteintech is a Polyclonal antibody targeting ASCL2 in WB, IHC, ELISA applications with reactivity to human samples\n21368-1-AP targets ASCL2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MKN-45 cells, Caco-2 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAchaete-scute complex homolog 2 (Drosophila), also known as ASCL2, is an imprinted human gene. This gene is involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system, particularly important during implantation of the developing embryo, specifically in placental development and neuronal precursor determination. ASCL2 has been reported involved in tumor progression, being upregulated in colorectal tumors, and involvement in metastasis could be attributed to ASCL2-promoted cellular self-renewal as opposed to cellular differentiation (PMID: 30096149 16568095).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15839 Product name: Recombinant human ASCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-193 aa of BC057801 Sequence: LQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY Predict reactive species\nFull Name: achaete-scute complex homolog 2 (Drosophila)\nCalculated Molecular Weight: 193 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC057801\nGene Symbol: ASCL2\nGene ID (NCBI): 430\nRRID: AB_2935452\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99929\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869516583081,"sku":"21368-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21368-1-ap","provider":"Iright","version":"1.0","type":"link"}