{"product_id":"proteintech-21382-1-ap","title":"Proteintech, 21382-1-AP, EPHB3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPHB3 (21382-1-AP) by Proteintech is a Polyclonal antibody targeting EPHB3 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n21382-1-AP targets EPHB3 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPHB3 is a member of the Eph receptor tyrosine kinase family. The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). The EPHB3 protein has multiple functions in the nervous system, including regulating neural networks, participating in epileptic activity, and playing a role in repair after spinal cord injury.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16016 Product name: Recombinant human EPHB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-390 aa of BC052968 Sequence: EWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACS Predict reactive species\nFull Name: EPH receptor B3\nCalculated Molecular Weight: 998 aa, 110 kDa\nGenBank Accession Number: BC052968\nGene Symbol: EPHB3\nGene ID (NCBI): 2049\nRRID: AB_3669366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P54753\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887608942761,"sku":"21382-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21382-1-ap","provider":"Iright","version":"1.0","type":"link"}