{"product_id":"proteintech-21386-1-ap","title":"Proteintech, 21386-1-AP, PAX3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAX3 (21386-1-AP) by Proteintech is a Polyclonal antibody targeting PAX3 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n21386-1-AP targets PAX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue,  HEK-293 cells\nPositive IP detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAX3, a transcription factor and multifunctional regulatory protein, is normally expressed during embryonic development. In the nervous system, PAX3 is involved in neural tube closure, neural crest development, and peripheral neuron differentiation. In the present study, PAX3 was reported as a novel regulator of GFAP transcription, and the overexpression and suppression of PAX3 could inhibit and promote NSC differentiation, respectively. In muscle development, PAX3 ensures the survival of myogenic progenitor cells with Pax3-expressing progenitors giving rise to both skeletal and smooth muscle cells. PAX3 also has a well-established role in the development of melanocytes during embryogenesis, and has recently been characterized as a molecular switch in the mature melanocyte. Mutations in PAX3 can cause Waardenburg syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16021 Product name: Recombinant human PAX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-426 aa of BC101301 Sequence: QSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVS Predict reactive species\nFull Name: paired box 3\nCalculated Molecular Weight: 484 aa, 53 kDa\nObserved Molecular Weight: 56-60 kDa\nGenBank Accession Number: BC101301\nGene Symbol: PAX3\nGene ID (NCBI): 5077\nRRID: AB_10732817\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P23760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421457577,"sku":"21386-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21386-1-ap","provider":"Iright","version":"1.0","type":"link"}