{"product_id":"proteintech-21390-1-ap","title":"Proteintech, 21390-1-AP, CCDC153 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC153 (21390-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC153 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21390-1-AP targets CCDC153 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HepG2 cells,  L02 cells,  human brain tissue,  HeLa cells\nPositive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells,  Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCDC153's properties have yet to be elucidated. However, research suggests that it may be a neuronal subtype marker (PMID: 28166221). It has a molecular weight of 24 KDa and is often observed on a Western blot as a dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16044 Product name: Recombinant human CCDC153 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC101443 Sequence: MSRQCHALQEDMQTHSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQALAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL Predict reactive species\nFull Name: coiled-coil domain containing 153\nCalculated Molecular Weight: 210 aa, 24 kDa\nObserved Molecular Weight: 45-48 kDa\nGenBank Accession Number: BC101443\nGene Symbol: CCDC153\nGene ID (NCBI): 283152\nRRID: AB_10858621\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q494R4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885905236137,"sku":"21390-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21390-1-ap","provider":"Iright","version":"1.0","type":"link"}