{"product_id":"proteintech-21401-1-ap","title":"Proteintech, 21401-1-AP, PAK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PAK1 (21401-1-AP) by Proteintech is a Polyclonal antibody targeting PAK1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21401-1-AP targets PAK1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C6 cells, Jurkat cells,  NIH\/3T3 cells,  MCF-7 cells,  HeLa cells,  K-562 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse brain tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe p21-Activated kinase 1 (PAK1), a member of serine-threonine kinases family, was initially identified as an interactor of the Rho GTPases RAC1 and CDC42, which affect a wide range of processes associated with cell motility, survival, metabolism, cell cycle, proliferation, transformation, stress, inflammation, and gene expression(PMID: 32863957). PAK1 is over-expressed in various malignancies such as ovarian, breast, lung, and bladder cancers, and is closely associated with tumor invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16102 Product name: Recombinant human PAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-65 aa of BC109299 Sequence: APPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTN Predict reactive species\nFull Name: p21 protein (Cdc42\/Rac)-activated kinase 1\nCalculated Molecular Weight: 553 aa, 62 kDa\nObserved Molecular Weight: 61-65 kDa\nGenBank Accession Number: BC109299\nGene Symbol: PAK1\nGene ID (NCBI): 5058\nRRID: AB_11232232\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13153\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868869742761,"sku":"21401-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21401-1-ap","provider":"Iright","version":"1.0","type":"link"}