{"product_id":"proteintech-21434-1-ap","title":"Proteintech, 21434-1-AP, ADAM21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM21 (21434-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM21 in WB, ELISA applications with reactivity to human samples\n21434-1-AP targets ADAM21 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM21 is also present in growing axonal tracts during postnatal development and in growing primary olfactory axons in adults. In the olfactory nerve layer, ADAM21 often, but not always, colocalizes with OMP, a marker of mature olfactory neurons, but is not colocalized with the immature marker βIII-tubulin. The exclusive expression of ADAM21 in human testis and its sequence similarity with the fertilins suggest that it is also expressed on sperm cells and involved in sperm maturation and\/or fertilization(PMID:9469942).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16042 Product name: Recombinant human ADAM21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 244-408 aa of BC109024 Sequence: SMYQQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFSQWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQHDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKR Predict reactive species\nFull Name: ADAM metallopeptidase domain 21\nCalculated Molecular Weight: 722 aa, 81 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC109024\nGene Symbol: ADAM21\nGene ID (NCBI): 8747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKJ8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869802156201,"sku":"21434-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21434-1-ap","provider":"Iright","version":"1.0","type":"link"}