{"product_id":"proteintech-21462-1-ap","title":"Proteintech, 21462-1-AP, MMACHC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMACHC (21462-1-AP) by Proteintech is a Polyclonal antibody targeting MMACHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n21462-1-AP targets MMACHC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, HeLa cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMACHC, also named as CblC, is located on chromosome 1 and comprises four coding exons. Human MMACHC catalyzes the reductive decyanation of cyanocobalamin and may serve as a trafficking chaperone for intracellular cobalamin. It also catalyzes the glutathione-dependent reductive demethylation of methylcobalamin, and, with much lower efficiency, the glutathione-dependent reductive demethylation of adenosylcobalamin. NMACHC binds cyanocobalamin, adenosylcobalamin, methylcobalamin and other, related vitamin B12 derivatives.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15001 Product name: Recombinant human MMACHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC006122 Sequence: MFDRALKPFLQSCHLRMLTDPVDQCVAYHLGRVRESLPELQIEIIADYEVHPNRRPKILAQTAAHVAGAAYYYQRQDVEADPWGNQRISGVCIHPRFGGWFAIRGVVLLPGIEVPDLPPRKPHDCVPTRADRIALLEGFNFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPASPGP Predict reactive species\nFull Name: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria\nCalculated Molecular Weight: 282 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC006122\nGene Symbol: MMACHC\nGene ID (NCBI): 25974\nRRID: AB_10732959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4U1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887720812713,"sku":"21462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21462-1-ap","provider":"Iright","version":"1.0","type":"link"}