{"product_id":"proteintech-21497-1-ap","title":"Proteintech, 21497-1-AP, NEBL Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEBL (21497-1-AP) by Proteintech is a Polyclonal antibody targeting NEBL in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n21497-1-AP targets NEBL in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNebulette, also known as NEBL, is a cardiac-specific isoform belonging to the nebulin family of proteins. Nebulette has 23 modular repeat structures of 35 amino acid residues each. Nebulette has an acidic region with unknown structure at its N-terminus, and a serine-rich region adjacent to an SH3 domain at its C-terminus (PMID: 2037050, 20951588). Nebulette functionally links sarcomeric actin to the desmin intermediate filaments in the heart muscle sarcomeres (PubMed:27733623). Nebulette is abundantly expressed in cardiac muscle at Z-disc regions, but not in skeletal or smooth muscle.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag15882 Product name: Recombinant human NEBL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-550 aa of BC110453 Sequence: QGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEKFDNEMKDKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPVSDLPNLLFLDHVLKASKMLSGREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQSQVKYKEEYEKNKGKPMLEFVETPSYQASKEAQKMQSEKVYKEDFEKEIKGRSSLDLDKTPEFLHVKYITNLLREKEYKKDLENEIKGKGMELNSEVLDIQRAKRASEMASEKEYKKDLESIIKGKGMQAGTDTLEMQHAKKAAEIASEKDYKRDLETEIKGKGMQVSTDTLDVQRAKKASEMASQKQYKKDLENEIKGKGMQVSMDIPDILRAKR Predict reactive species\nFull Name: nebulette\nCalculated Molecular Weight: 1014 aa, 116 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC110453\nGene Symbol: NEBL\nGene ID (NCBI): 10529\nRRID: AB_3085659\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O76041\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887734345897,"sku":"21497-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21497-1-ap","provider":"Iright","version":"1.0","type":"link"}