{"product_id":"proteintech-21513-1-ap","title":"Proteintech, 21513-1-AP, HAND2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HAND2 (21513-1-AP) by Proteintech is a Polyclonal antibody targeting HAND2 in WB, ELISA applications with reactivity to human samples\n21513-1-AP targets HAND2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SH-SY5Y cells,  SK-N-SH cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHAND2 is a bHLH transcription factor essential for cardiac morphogenesis, neural crest differentiation, and limb development. Acting in the nucleus, it regulates gene networks shaping embryonic heart structure, craniofacial patterning, and limb polarity. Dysregulation of HAND2 is linked to congenital heart defects, craniofacial disorders, and certain cancers, highlighting its importance in both development and disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16038 Product name: Recombinant human HAND2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC101406 Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYAS Predict reactive species\nFull Name: heart and neural crest derivatives expressed 2\nCalculated Molecular Weight: 217 aa, 24 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC101406\nGene Symbol: HAND2\nGene ID (NCBI): 9464\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887662911657,"sku":"21513-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21513-1-ap","provider":"Iright","version":"1.0","type":"link"}