{"product_id":"proteintech-21526-1-ap","title":"Proteintech, 21526-1-AP, Glypican 6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Glypican 6 (21526-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 6 in WB, ELISA applications with reactivity to human samples\n21526-1-AP targets Glypican 6 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, L02 cells,  MG-63 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlypican-6 (GPC6) is a glycosylphosphatidylinositol-anchored heparan-sulfate proteoglycan that regulates cell-surface signaling cues during development and disease. GPC6 binds Hedgehog ligands and facilitates their interaction with the receptor Patched, thereby amplifying Hh signaling required for long-bone and gastric\/intestinal elongation. (PMID: 35235423)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16135 Product name: Recombinant human GPC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-278 aa of BC106947 Sequence: RAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCL Predict reactive species\nFull Name: glypican 6\nCalculated Molecular Weight: 555 aa, 63 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC106947\nGene Symbol: GPC6\nGene ID (NCBI): 10082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887652917417,"sku":"21526-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21526-1-ap","provider":"Iright","version":"1.0","type":"link"}