{"product_id":"proteintech-21537-1-ap","title":"Proteintech, 21537-1-AP, FAM134B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM134B (21537-1-AP) by Proteintech is a Polyclonal antibody targeting FAM134B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n21537-1-AP targets FAM134B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, HEK-293 cells,  rat brain tissue,  mouse brain,  mouse cerebellum\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: mouse brain tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM134B, also known as the reticulophagy regulator 1 (RETREG1) or JK-1, is a member of the family with sequence similarity 134. FAM134B is an important ER-phagy receptor. FAM134B regulates the size and shape of the ER and participates in some ER-phagy-related processes(PMID: 33199694). FAM134B inhibition contributes to impair proteostasis in the ER due to the accumulation of misfolded or aggregated proteins, which in turn leads to compromised neuronal survival and progressive neuronal degenerative diseases. In addition, FAM134B mutations are common in patients with colorectal adenocarcinoma, and oesophageal squamous cell carcinoma(PMID: 29226326).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16176 Product name: Recombinant human FAM134B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 282-455 aa of BC030517 Sequence: ELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPIPEEDTDTEEGDDF Predict reactive species\nFull Name: family with sequence similarity 134, member B\nCalculated Molecular Weight: 497 aa, 55 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: BC030517\nGene Symbol: FAM134B\nGene ID (NCBI): 54463\nRRID: AB_2878879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H6L5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839825577,"sku":"21537-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21537-1-ap","provider":"Iright","version":"1.0","type":"link"}