{"product_id":"proteintech-21576-1-ap","title":"Proteintech, 21576-1-AP, RHOG Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOG (21576-1-AP) by Proteintech is a Polyclonal antibody targeting RHOG in WB, IP, ELISA applications with reactivity to human samples\n21576-1-AP targets RHOG in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HeLa cells,  MCF-7 cells,  K-562 cells\nPositive IP detected in: Jurkat cells, HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRHOG, also named as ARHG, belongs to the small GTPase superfamily and Rho family. It is required for the formation of membrane ruffles during macropinocytosis. And it is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, it is activated by SopB and SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. This antibody is specific to RHOG.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16118 Product name: Recombinant human RHOG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 74-191 aa of BC104178 Sequence: QTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL Predict reactive species\nFull Name: ras homolog gene family, member G (rho G)\nCalculated Molecular Weight: 191 aa, 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC104178\nGene Symbol: RHOG\nGene ID (NCBI): 391\nRRID: AB_2878887\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P84095\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887784612009,"sku":"21576-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21576-1-ap","provider":"Iright","version":"1.0","type":"link"}