{"product_id":"proteintech-21600-1-ap","title":"Proteintech, 21600-1-AP, TTC7A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTC7A (21600-1-AP) by Proteintech is a Polyclonal antibody targeting TTC7A in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n21600-1-AP targets TTC7A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SW480 cells, K-562 cells,  mouse colon tissue,  mouse small intestine tissue,  PC-3 cells,  mouse thymus tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTTC7A (TPR repeat protein 7A) is expressed in enterocytes within the duodenum, ileum, and colon, and has a role in enterocyte survival and function. Mutations in the TTC7A gene can result in a spectrum of intestinal disease, including multiple intestinal atresia (MIA) and very early onset inflammatory bowel diseases (VEOIBD). Functional analysis revealed that TTC7A binds to and facilitates the transport of PI4KIIIa from the trans-Golgi to the plasma membrane, while loss of TTC7A results in dysregulation of PI4KIIIa signaling. This antibody specially recognizes endogenous TTC7A. (24417819)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16212 Product name: Recombinant human TTC7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 149-465 aa of BC114365 Sequence: DATLKSKQDELHRKALQTLERAQQLAPSDPQVILYVSLQLALVRQISSAMEQLQEALKVRKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPGNFNLMFTKVKLEQVLKGPEEALVTCRQVLRLWQTLYSFSQLGGLEKDGSFGEGLTMKKQSGMHLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLKQGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGL Predict reactive species\nFull Name: tetratricopeptide repeat domain 7A\nCalculated Molecular Weight: 858 aa, 96 kDa\nObserved Molecular Weight: 96 kDa\nGenBank Accession Number: BC114365\nGene Symbol: TTC7A\nGene ID (NCBI): 57217\nRRID: AB_10733221\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULT0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869506293929,"sku":"21600-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21600-1-ap","provider":"Iright","version":"1.0","type":"link"}