{"product_id":"proteintech-21608-1-ap","title":"Proteintech, 21608-1-AP, NRCAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NRCAM (21608-1-AP) by Proteintech is a Polyclonal antibody targeting NRCAM in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21608-1-AP targets NRCAM in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  HEK-293 cells,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16237 Product name: Recombinant human NRCAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-628 aa of BC098401 Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV Predict reactive species\nFull Name: neuronal cell adhesion molecule\nCalculated Molecular Weight: 1304 aa, 144 kDa\nObserved Molecular Weight: 130-136 kDa\nGenBank Accession Number: BC098401\nGene Symbol: NRCAM\nGene ID (NCBI): 4897\nRRID: AB_10859786\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92823\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985512105,"sku":"21608-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21608-1-ap","provider":"Iright","version":"1.0","type":"link"}