{"product_id":"proteintech-21614-1-ap","title":"Proteintech, 21614-1-AP, SGCZ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SGCZ (21614-1-AP) by Proteintech is a Polyclonal antibody targeting SGCZ in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n21614-1-AP targets SGCZ in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse brain tissue,  rat heart tissue\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSarcoglycan zeta, also known as SGCZ, ZSG1, is part of the sarcoglycan complex. The sarcoglycan complex is part of the dystrophin-associated glycoprotein complex (DGC), which bridges the inner cytoskeleton and the extracellular matrix. SGCZ plays a role in the maintenance of striated muscle membrane stability. SGCZ was also found as a component of the vascular smooth muscle sarcoglycan complex. SGCZ was reduced at the membrane in muscular dystrophy (PMID: 12189167).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16305 Product name: Recombinant human SGCZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 67-265 aa of BC125037 Sequence: SPLVLQSDRNVTVNARNHMGQLTGQLTIGADAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVTGTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLIMEAPRGVQVSAAAGDFKATCRKELHLQSTEGEIFLNAETIKLGNLPTGSFSSSSPSSSSSRQTVYELCVCPNGKLYLSPAGVGSTCQSSSNICLWS Predict reactive species\nFull Name: sarcoglycan zeta\nCalculated Molecular Weight: 265 aa, 30 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: BC125037\nGene Symbol: SGCZ\nGene ID (NCBI): 137868\nRRID: AB_3085662\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96LD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887799521449,"sku":"21614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21614-1-ap","provider":"Iright","version":"1.0","type":"link"}