{"product_id":"proteintech-21617-1-ap","title":"Proteintech, 21617-1-AP, MRP63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRP63 (21617-1-AP) by Proteintech is a Polyclonal antibody targeting MRP63 in WB, IHC, ELISA applications with reactivity to human samples\n21617-1-AP targets MRP63 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial ribosomal protein 63 is a component of the mitochondrial Large ribosomal subunit (mt-LSU), also known as the Large ribosomal subunit protein mL63.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag7289 Product name: Recombinant human MRP63 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC000002 Sequence: MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS Predict reactive species\nFull Name: mitochondrial ribosomal protein 63\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC000002\nGene Symbol: MRP63\nGene ID (NCBI): 78988\nRRID: AB_3085663\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQC6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887724318889,"sku":"21617-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21617-1-ap","provider":"Iright","version":"1.0","type":"link"}