{"product_id":"proteintech-21726-1-ap","title":"Proteintech, 21726-1-AP, SLC15A1\/PEPT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC15A1\/PEPT1 (21726-1-AP) by Proteintech is a Polyclonal antibody targeting SLC15A1\/PEPT1 in WB, ELISA applications with reactivity to human, mouse samples\n21726-1-AP targets SLC15A1\/PEPT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Caco-2 cells,  HT-29 cells,  MOLT-4 cells,  mouse small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC15A1\/PEPT1 is a peptide transporter that transports oligopeptides of 2 to 4 amino acids with a preference for dipeptides. PEPT1 mediates transepithelial transport of muramyl and N-formylated bacterial dipeptides contributing to recognition of pathogenic bacteria by the mucosal immune system. PEPT1 is primarily expressed in the small intestine (PMID: 22194420). PEPT1 is also expressed in distal colon in rodents and humans and contributes to water absorption. 71 kDa nonglycosylated PEPT1 protein can be detected (PMID: 23660505).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16390 Product name: Recombinant human SLC15A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-580 aa of BC096327 Sequence: VAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFEDISANTVN Predict reactive species\nFull Name: solute carrier family 15 (oligopeptide transporter), member 1\nCalculated Molecular Weight: 708 aa, 79 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC096327\nGene Symbol: SLC15A1\/PEPT1\nGene ID (NCBI): 6564\nRRID: AB_3085668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P46059\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869764636841,"sku":"21726-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21726-1-ap","provider":"Iright","version":"1.0","type":"link"}