{"product_id":"proteintech-21765-1-ap","title":"Proteintech, 21765-1-AP, FFAR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FFAR2 (21765-1-AP) by Proteintech is a Polyclonal antibody targeting FFAR2 in WB, ELISA applications with reactivity to human, mouse samples\n21765-1-AP targets FFAR2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFree fatty acid receptors (FFAR) play significant roles in various physiological processes through interaction with their ligands, fatty acids. Free fatty acid receptor 2 (FFAR2, also known as FFA2 or GPR43) is a receptor for short-chain fatty acids (SCFAs) and plays a role in the regulation of whole-body energy homeostasis and intestinal immunity (PMID: 12684041). It has been considered a therapeutic target for metabolic and inflammatory conditions (PMID: 23589301). FFAR2 has a calculated molecular weight of 37 kDa and can be glycosylated. The higher apparent molecular weight of 50 kDa has been reported, probably due to glycosylation (PMID: 31707282; 28131568).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16367 Product name: Recombinant human FFAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 270-330 aa of BC096198 Sequence: PLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE Predict reactive species\nFull Name: free fatty acid receptor 2\nCalculated Molecular Weight: 330 aa, 37 kDa\nObserved Molecular Weight: 37-50 kDa\nGenBank Accession Number: BC096198\nGene Symbol: FFAR2\nGene ID (NCBI): 2867\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15552\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638696105,"sku":"21765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21765-1-ap","provider":"Iright","version":"1.0","type":"link"}