{"product_id":"proteintech-21766-1-ap","title":"Proteintech, 21766-1-AP, GABRA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GABRA6 (21766-1-AP) by Proteintech is a Polyclonal antibody targeting GABRA6 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n21766-1-AP targets GABRA6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABAA receptors, which are ligand-gated chloride channels. GABAA receptors are formed by pentameric assembly of 19 different subunit subtypes (α1-α6, β1-β3, γ1-γ3, δ, ɛ, π, θ and ρ1-ρ3) (PMID: 21930603). The mutation R46W of GABRA6 is associated with the pathogenesis of childhood absence epilepsy (CAE) (PMID: 21930603).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16375 Product name: Recombinant human GABRA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 329-424 aa of BC096241 Sequence: NLQTQKAKRKAQFAAPPTVTISKATEPLEAEIVLHPDSKYHLKKRITSLSLPIVSSSEANKVLTRAPILQSTPVTPPPLSPAFGGTSKIDQYSRIL Predict reactive species\nFull Name: gamma-aminobutyric acid (GABA) A receptor, alpha 6\nCalculated Molecular Weight: 453 aa, 51 kDa\nGenBank Accession Number: BC096241\nGene Symbol: GABRA6\nGene ID (NCBI): 2559\nRRID: AB_3085671\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16445\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887645708457,"sku":"21766-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21766-1-ap","provider":"Iright","version":"1.0","type":"link"}