{"product_id":"proteintech-21771-1-ap","title":"Proteintech, 21771-1-AP, LCE1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LCE1B (21771-1-AP) by Proteintech is a Polyclonal antibody targeting LCE1B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n21771-1-AP targets LCE1B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells,  mouse skin tissue,  rat skin tissue\nPositive IHC detected in: human skin tissue,  human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman LCE1B (Late cornified envelope protein 1B), also named late envelope protein 2 (LEP2), is located at human Chromosome1q21 which contains multiple LCE clusters. LCE1B gene is predicated to encode a 118-aa protein, and is currently evidenced at transcript level. Its expression was skin-specific and was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue (PMID: 15854049). LCE genes respond to environmental stimuli such as calcium levels and ultraviolet (UV) light, however, LCE groups have distinct functions (PMID: 15854049).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16442 Product name: Recombinant human LCE1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC104232 Sequence: MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC Predict reactive species\nFull Name: late cornified envelope 1B\nCalculated Molecular Weight: 118 aa, 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC104232\nGene Symbol: LCE1B\nGene ID (NCBI): 353132\nRRID: AB_10858482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T7P3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887701938345,"sku":"21771-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21771-1-ap","provider":"Iright","version":"1.0","type":"link"}