{"product_id":"proteintech-21862-1-ap","title":"Proteintech, 21862-1-AP, Intersectin 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Intersectin 1 (21862-1-AP) by Proteintech is a Polyclonal antibody targeting Intersectin 1 in WB, IHC, ELISA applications with reactivity to human samples\n21862-1-AP targets Intersectin 1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\nPositive IHC detected in: human stomach tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntersectin 1 (ITSN1) is a multidomain adaptor protein that plays a crucial role in various cellular processes, particularly in the nervous system. It is involved in clathrin-mediated endocytosis, signal transduction, and the regulation of the actin cytoskeleton. The protein is highly abundant in neurons and has been implicated in neurodevelopmental disorders, such as autism spectrum disorders, intellectual disability, and epilepsy. Recent studies have identified de novo variants in the ITSN1 gene in patients with these disorders, suggesting a link between ITSN1 and brain development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16517 Product name: Recombinant human ITSN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 610-926 aa of BC116186 Sequence: LREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQWLEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAVQAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTSSEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRA Predict reactive species\nFull Name: intersectin 1 (SH3 domain protein)\nCalculated Molecular Weight: 1721 aa, 195 kDa\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC116186\nGene Symbol: Intersectin 1\nGene ID (NCBI): 6453\nRRID: AB_2878931\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15811\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869552136361,"sku":"21862-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21862-1-ap","provider":"Iright","version":"1.0","type":"link"}