{"product_id":"proteintech-21871-1-ap","title":"Proteintech, 21871-1-AP, SLC38A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC38A9 (21871-1-AP) by Proteintech is a Polyclonal antibody targeting SLC38A9 in WB, IF-P, ELISA applications with reactivity to Human, Mouse samples\n21871-1-AP targets SLC38A9 in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9) was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16174 Product name: Recombinant human SLC38A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-131 aa of BC101362 Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM Predict reactive species\nFull Name: solute carrier family 38, member 9\nCalculated Molecular Weight: 561 aa, 64 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC101362\nGene Symbol: SLC38A9\nGene ID (NCBI): 153129\nRRID: AB_3085676\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NBW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887806664873,"sku":"21871-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-21871-1-ap","provider":"Iright","version":"1.0","type":"link"}